PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_38_00048
Common NameCHLNCDRAFT_141785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 294aa    MW: 30631.9 Da    PI: 8.8834
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_38_00048genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.93.5e-2666120155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +pr+ W+peLH++F  av++LGG+  AtPk ile+m+ kgL+l++vkSHLQk+Rl
  IGS.gm_38_00048  66 RPRMLWSPELHKEFEAAVHKLGGPFSATPKCILEMMGTKGLSLTNVKSHLQKFRL 120
                      59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2365123IPR009057Homeodomain-like
SuperFamilySSF466891.33E-1365122IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-2167121IPR006447Myb domain, plants
PfamPF002498.1E-868118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MPRRRAQRIT EQAEPSTSSA CPSSDAETLD EGRGADSGTT DEPLSQPAEP SSPAAPRCGG  60
GTLRGRPRML WSPELHKEFE AAVHKLGGPF SATPKCILEM MGTKGLSLTN VKSHLQKFRL  120
KAHKRAQLQA AEAEATAVAV AGSPRPTKAG RAGGGVASTG SLPAGLSAAV LPNNMVPITT  180
AGAVAAGQQG EVSFADPELA AQAAAWQRKR LGLVAAIQGA LQACQSPTAH LSQHHEQAVV  240
QWQLENLHCL HVLHSLHMMQ MRQHLAAAAC LKEKAQQAAA NAPLPPEALQ LVT*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005842930.10.0hypothetical protein CHLNCDRAFT_141785
TrEMBLE1ZTL40.0E1ZTL4_CHLVA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.15e-17G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]